FS2P1_MOUSE   Q0VAX3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q0VAX3

Recommended name:Fatty acid desaturase 2-like protein FADS2B

EC number:

Alternative names:(Fatty acid desaturase 2B, pseudogene)

Cleaved into:

GeneID:228151

Gene names  (primary ):Fads2b

Gene names  (synonym ):

Gene names  (ORF ):

Length:487

Mass:57082

Sequence:MKLEEKLEHNESLVGKSRPCLHDTHQANGKPIANGNPTANGKVEVYEKQEANGKGNRLGKCLNLYTWQEIQRHSQEADQWLVIDRKVYNVTDWAGKHPGGRRVLNHYAGQDATDAFRAMHLDLGMVKLYLKPLLIGELSPEEPSQEKNKNAQLVEDFRELRKTLEAMNMFSANLRFFFLHLAQILILEISAWLILHHFGSSWLVTILISFLLTVSQAQCSFLQHDLGHLSMFKKSKWNHLMHKFVMCHLKGLSADWWNYRHFQHHVKPNIYPKDPDIDVGPLFLVGDTQPIKYGKKKIKYIDYEKQHLYFYMVALPFLMPVYFNLQSMQVMYLRKYWMDIAWVSSFYIRYFITFGPFYGIFGTVLLIYLVKFIESPWIAYVTQMSHIPMKMSSEENHDWLSTQVVATCNIEQSFFNDWFTGHLNFQIEHHLFPTMPRHNYHKVAPLVKSLCAKHGLQYINKPILKAFGDIVRSLKKSASLWMNAYYE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Fatty acid desaturase type 1 family


   💬 WhatsApp