E41LB_MOUSE Q9JMC8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JMC8
Recommended name：Band 4.1-like protein 4B
EC number：
Alternative names：(Erythrocyte membrane protein band 4.1-like 4B) (Protein EHM2)
Cleaved into：
GeneID：54357
Gene names (primary )：Epb41l4b
Gene names (synonym )：Ehm2 Epb4.1l4b Lulu2
Gene names (ORF )：
Length：527
Mass：59564
Sequence：MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSVLPAAPGGSVFPAGGGPLLTGGAAVHISASGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVTHWLDHAKPIKKQMKVGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKEYRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPSNSKSARSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKANPEVHNYQPQYHPDVHPSQPRWRPHSPNVSNHSICKQNKPCFQDDRPHWKTSASGDGSHFDYVQDQNQRNLGGAYSVTYRDKLMTAL
Tissue specificity：Expressed in mouse liver cells, with lower amounts in lung, kidney and in 7- to 17-day embryos. Expression not detected in adult mouse heart, brain, spleen, skeletal muscle or testis. {ECO:0000269|PubMed:10783258}.
Induction：
Developmental stage：
Protein families：