EMX2_MOUSE   Q04744


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q04744

Recommended name:Homeobox protein EMX2

EC number:

Alternative names:(Empty spiracles homolog 2) (Empty spiracles-like protein 2)

Cleaved into:

GeneID:13797

Gene names  (primary ):Emx2

Gene names  (synonym ):Emx-2

Gene names  (ORF ):

Length:253

Mass:28374

Sequence:MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD

Tissue specificity:Cerebral cortex. {ECO:0000269|PubMed:1352754}.

Induction:

Developmental stage:

Protein families:EMX homeobox family


   💬 WhatsApp