IF4E3_MOUSE Q9DBB5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DBB5
Recommended name：Eukaryotic translation initiation factor 4E type 3
EC number：
Alternative names：(eIF-4E type 3) (eIF-4E3) (eIF4E type 3) (eIF4E-3)
Cleaved into：
GeneID：66892
Gene names (primary )：Eif4e3
Gene names (synonym )：
Gene names (ORF )：
Length：207
Mass：22836
Sequence：MALPPAAAPPGANEPLDKALSALPPEPGGVPLHSPWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEIIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIHQLLPHIAFKAVFYKPHEEHHAFEGGRGKH
Tissue specificity：Only expressed in heart, skeletal muscle, lung and spleen. {ECO:0000269|PubMed:15153109}.
Induction：
Developmental stage：
Protein families：Eukaryotic initiation factor 4E family