CLC9A_MOUSE Q8BRU4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BRU4
Recommended name：C-type lectin domain family 9 member A
EC number：
Alternative names：(Dendritic cell natural killer lectin group receptor 1) (CD antigen CD370)
Cleaved into：
GeneID：232414
Gene names (primary )：Clec9a
Gene names (synonym )：Dngr-1
Gene names (ORF )：
Length：238
Mass：27014
Sequence：MHAEEIYTSLQWDIPTSEASQKCQSPSKCSGAWCVVTMISCVVCMGLLATSIFLGIKFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI
Tissue specificity：Isoform 4 expressed at high levels by CD8(+) dendritic cells (DCs), and at low levels by plasmacytoid DCs but not by other hematopoietic cells. {ECO:0000269|PubMed:18408006, ECO:0000269|PubMed:18497879}.
Induction：
Developmental stage：
Protein families：