VSIG1_MOUSE   Q9D2J4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D2J4

Recommended name:V-set and immunoglobulin domain-containing protein 1

EC number:

Alternative names:(Cell surface A33 antigen) (Glycoprotein A34)

Cleaved into:

GeneID:78789

Gene names  (primary ):Vsig1

Gene names  (synonym ):Gpa34

Gene names  (ORF ):

Length:407

Mass:44015

Sequence:MMVFAFWKVFLILNCLAGQVSMVQVTIPDTFVNVTVGSNVTLLCLYTTTEKSLEKLSIQWSFFHNKEMEEPISIYYSEGGQASAIGQFKDRIIGATNPGNASITILHMQPADSGIYICDVNNPPHFVGKNQGLLDVTVLVKPSKPFCTIQGRPEAGHPISLSCLSAFGTPSPLYYWYNIEGNTIVPVKESFNTATGVLVIGNLTNFEQGYYQCTAINSLGNSSCEIDLTSSHPEVGIIIGALVGALIGAAVIICVVYFARNKVKSKQQKNLNSSTELEPMTKVHHPQQSEAISADGVQLEGTLPSSIHAGHNTEPTTTAVLEPEYEPNPPLETTTQPDPEPEGSVPVLAPEAEIQPHPELDPETETEPEPEPEPKPEPEPEPELEPDPQSGVIIEPLSKAGEDTVKA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp