HPLN1_MOUSE   Q9QUP5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QUP5

Recommended name:Hyaluronan and proteoglycan link protein 1

EC number:

Alternative names:(Cartilage-linking protein 1) (Cartilage-link protein) (Proteoglycan link protein)

Cleaved into:

GeneID:12950

Gene names  (primary ):Hapln1

Gene names  (synonym ):Crtl1

Gene names  (ORF ):

Length:356

Mass:40478

Sequence:MRSLLLLVLISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:12732630}.

Induction:

Developmental stage:

Protein families:HAPLN family


   💬 WhatsApp