PLAT3_MOUSE Q8R3U1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R3U1
Recommended name：Phospholipase A and acyltransferase 3
EC number：EC 2.3.1.-
Alternative names：(Adipose-specific phospholipase A2) (AdPLA) (Group XVI phospholipase A2) (H-rev 107 protein homolog) (HRAS-like suppressor 3) (HRSL3)
Cleaved into：
GeneID：225845
Gene names (primary )：Plaat3
Gene names (synonym )：H-rev107 Hrasls3 Hrev107 Pla2g16
Gene names (ORF )：
Length：162
Mass：17872
Sequence：MLAPIPEPKPGDLIEIFRPMYRHWAIYVGDGYVIHLAPPSEIAGAGAASIMSALTDKAIVKKELLCHVAGKDKYQVNNKHDEEYTPLPLSKIIQRAERLVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKAVGIAGVGLAALGLVGVMLSRNKKQKQ
Tissue specificity：Ubiquitously expressed in normal tissues but down-regulated in primary carcinomas or in many cell lines derived from tumors (PubMed:12055182). Highly expressed in white adipose tissue and in adipocytes (PubMed:18614531, PubMed:19136964). Expressed at lower levels in brown adipose tissue (PubMed:18614531, PubMed:19136964). {ECO:0000269|PubMed:12055182, ECO:0000269|PubMed:18614531, ECO:0000269|PubMed:19136964}.
Induction：
Developmental stage：
Protein families：H-rev107 family