4EBP1_MOUSE   Q60876


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q60876

Recommended name:Eukaryotic translation initiation factor 4E-binding protein 1

EC number:

Alternative names:(4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)

Cleaved into:

GeneID:13685

Gene names  (primary ):Eif4ebp1

Gene names  (synonym ):

Gene names  (ORF ):

Length:117

Mass:12325

Sequence:MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI

Tissue specificity:Highest expression in fat cells. {ECO:0000269|PubMed:7629182}.

Induction:

Developmental stage:

Protein families:EIF4E-binding protein family


   💬 WhatsApp