PSMD8_MOUSE   Q9CX56


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CX56

Recommended name:26S proteasome non-ATPase regulatory subunit 8

EC number:

Alternative names:(26S proteasome regulatory subunit RPN12) (26S proteasome regulatory subunit S14)

Cleaved into:

GeneID:57296

Gene names  (primary ):Psmd8

Gene names  (synonym ):

Gene names  (ORF ):

Length:353

Mass:39930

Sequence:MFIKGRAAKTPRGEPRRSSRGGRKLAVVAPPPVLGSTSRPHFRRESIARRRCRKSGRRLAASRKMAATAATVNGSTTVSSSGPAATSVGILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV

Tissue specificity:Expressed in the Sertoli cells of the testis. {ECO:0000269|PubMed:31112734}.

Induction:

Developmental stage:

Protein families:Proteasome subunit S14 family


   💬 WhatsApp