CXCL3_MOUSE   Q6W5C0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6W5C0

Recommended name:C-X-C motif chemokine 3

EC number:

Alternative names:(Dendritic cell inflammatory protein 1)

Cleaved into:

GeneID:330122

Gene names  (primary ):Cxcl3

Gene names  (synonym ):Dcip1 Gm1960

Gene names  (ORF ):

Length:100

Mass:10686

Sequence:MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Tissue specificity:

Induction:By lipopolysaccharide. {ECO:0000269|PubMed:14764687}.

Developmental stage:

Protein families:Intercrine alpha (chemokine CxC) family


   💬 WhatsApp