BEX4_MOUSE Q9CWT2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CWT2
Recommended name：Protein BEX4
EC number：
Alternative names：(Brain-expressed X-linked protein 4)
Cleaved into：
GeneID：406217
Gene names (primary )：Bex4
Gene names (synonym )：
Gene names (ORF )：
Length：118
Mass：13820
Sequence：MASKFKQVILDLTVEKDKKDKKGGKASKQSEEEPHHLEEVENKKPGGNVRRKVRRLVPNFLWAIPNRHVDRNEGGEDVGRFVVQGTEVKRKTTEQQVRPYRRFRTPEPDNHYDFCLIP
Tissue specificity：Expressed in both Sertoli and germ cells as well as interstitial area of the testis (at protein level). {ECO:0000269|PubMed:28295929}.
Induction：Up-regulated by cadmium in testis (at protein level) (PubMed:28295929). Up-regulated by curcumin (PubMed:28145533). {ECO:0000269|PubMed:28145533, ECO:0000269|PubMed:28295929}.
Developmental stage：
Protein families：BEX family