GPER1_MOUSE Q8BMP4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BMP4
Recommended name：G-protein coupled estrogen receptor 1
EC number：
Alternative names：(Chemoattractant receptor-like 2) (G protein-coupled estrogen receptor 1) (G-protein coupled receptor 30) (Membrane estrogen receptor) (mER)
Cleaved into：
GeneID：76854
Gene names (primary )：Gper1
Gene names (synonym )：Cmkrl2 Gper Gpr30
Gene names (ORF )：
Length：375
Mass：42479
Sequence：MDATTPAQTVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGLIWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIMPFAIIGLCYSLIVRALIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWTQPGDTPCKQSFRHAYPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYVEQKTSLPALNRFCHATLKAVIPDSTEQSEVRFSSAV
Tissue specificity：Expressed in brain, heart, spleen, preadipocytes, mature adipocytes and primary hippocampal neurons. Expressed in neurons of the hippocampus, hypothalamic paraventricular nucleus (PVH), supraoptic nucleus (SON) and the median eminence. Expressed in the nucleus ambiguous (at protein level). Expressed in brain, pituitary gland, adrenal medulla, renal pelvis, ovary, endothelial cells, visceral fat tissues and islets of Langerhans. {ECO:0000269|PubMed:19420011, ECO:0000269|PubMed:21273787, ECO:0000269|PubMed:22306576, ECO:0000269|PubMed:23545157, ECO:0000269|PubMed:23674134, ECO:0000269|PubMed:23871778}.
Induction：Up-regulated during adipogenesis. {ECO:0000269|PubMed:23871778}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family