OAS1B_MOUSE Q60856
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60856
Recommended name：Inactive 2'-5'-oligoadenylate synthase 1B
EC number：
Alternative names：((2-5')oligo(A) synthase 1B) (2-5A synthase 1B) (2'-5'-oligoadenylate synthase-like protein 1)
Cleaved into：
GeneID：23961
Gene names (primary )：Oas1b
Gene names (synonym )：Flv Oias2
Gene names (ORF )：
Length：376
Mass：43620
Sequence：MEQDLRSIPASKLDKFIENHLPDTSFCADLREVIDALCALLKDRSFRGPVRRMRASKGVKGKGTTLKGRSDADLVVFLNNLTSFEDQLNQQGVLIKEIKKQLCEVQHERRCGVKFEVHSLRSPNSRALSFKLSAPDLLKEVKFDVLPAYDLLDHLNILKKPNQQFYANLISGRTPPGKEGKLSICFMGLRKYFLNCRPTKLKRLIRLVTHWYQLCKEKLGDPLPPQYALELLTVYAWEYGSRVTKFNTAQGFRTVLELVTKYKQLQIYWTVYYDFRHQEVSEYLHQQLKKDRPVILDPADPTRNIAGLNPKDWRRLAGEAAAWLQYPCFKYRDGSSVCSWEVPTEVGVPMKYLLCRIFWLLFWSLFHFIFGKTSSG
Tissue specificity：Highly expressed in lung, spleen and thymus (PubMed:12396720, PubMed:12186974). Also detected at lower levels in heart, kidney, liver, lung, skeletal muscle, testes, uterus and ovaries (PubMed:12396720, PubMed:12186974, PubMed:27663720). {ECO:0000269|PubMed:12186974, ECO:0000269|PubMed:12396720, ECO:0000269|PubMed:27663720}.
Induction：Up-regulated by the type I interferon IFNB1, in a STAT2-dependent manner (PubMed:22305621). Induced by polyinosinic:polycytidylic acid (poly I:C) (PubMed:12396720, PubMed:27663720). {ECO:0000269|PubMed:12396720, ECO:0000269|PubMed:22305621, ECO:0000269|PubMed:27663720}.
Developmental stage：Detected 1 week after birth in developing skin, testes, ovary, kidney and lung. {ECO:0000269|PubMed:27663720}.
Protein families：2-5A synthase family