TX101_MOUSE   Q9JMI7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JMI7

Recommended name:Testis-expressed protein 101

EC number:

Alternative names:(TES101-reactive protein) (TES101RP)

Cleaved into:

GeneID:56746

Gene names  (primary ):Tex101

Gene names  (synonym ):

Gene names  (ORF ):

Length:250

Mass:26998

Sequence:MGACRIQYVLLIFLLIASRWTLVQNTYCQVSQTLSLEDDPGRTFNWTSKAEQCNPGELCQETVLLIKADGTRTVVLASKSCVSQGGEAVTFIQYTAPPGLVAISYSNYCNDSLCNNKDSLASVWRVPETTATSNMSGTRHCPTCVALGSCSSAPSMPCANGTTQCYQGRLEFSGGGMDATVQVKGCTTTIGCRLMAMIDSVGPMTVKETCSYQSFLQPRKAEIGASQMPTSLWVLELLFPLLLLPLTHFP

Tissue specificity:Detected in testis and ovary (PubMed:11207211, PubMed:15689535, PubMed:15917346, PubMed:16388701, PubMed:23969891). Expressed in spermatocytes, spermatids and testicular spermatozoa, but not in spermatogonia or interstitial cells (PubMed:18620756). Expressed abundantly in testicular germ cells (TGCs) but mostly disappeared from epididymal spermatozoa (PubMed:23633567). {ECO:0000269|PubMed:11207211, ECO:0000269|PubMed:15689535, ECO:0000269|PubMed:15917346, ECO:0000269|PubMed:16388701, ECO:0000269|PubMed:18620756, ECO:0000269|PubMed:23633567, ECO:0000269|PubMed:23969891}.

Induction:

Developmental stage:Detected in prospermatogonia in embryos after 14 days of development and until 8 days after birth. Not detectable in spermatogonia from over 10 day old animals. Highly expressed in spermatocytes and spermatids from 12-28 day old animals, but not in spermatogonia. Detected in embryonic ovary after 14 days of development and in newly born animals. Expression is much reduced in ovary from 4 day old animals, and not detectable thereafter. Not detectable in oocytes that are surrounded by follicular cells. {ECO:0000269|PubMed:11207211, ECO:0000269|PubMed:15689535, ECO:0000269|PubMed:16388701, ECO:0000269|PubMed:16678124}.

Protein families:


   💬 WhatsApp