SOX17_MOUSE Q61473
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61473
Recommended name：Transcription factor SOX-17
EC number：
Alternative names：
Cleaved into：
GeneID：20671
Gene names (primary )：Sox17
Gene names (synonym )：Sox-17
Gene names (ORF )：
Length：419
Mass：44646
Sequence：MSSPDAGYASDDQSQPRSAQPAVMAGLGPCPWAESLSPLGDVKVKGEVVASSGAPAGTSGRAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALVEPQAGALGPEGGRVAMDGLGLPFPEPGYPAGPPLMSPHMGPHYRDCQGLGAPALDGYPLPTPDTSPLDGVEQDPAFFAAPLPGDCPAAGTYTYAPVSDYAVSVEPPAGPMRVGPDPSGPAMPGILAPPSALHLYYGAMGSPAASAGRGFHAQPQQPLQPQAPPPPPQQQHPAHGPGQPSPPPEALPCRDGTESNQPTELLGEVDRTEFEQYLPFVYKPEMGLPYQGHDCGVNLSDSHGAISSVVSDASSAVYYCNYPDI
Tissue specificity：Detected in lung and testis (PubMed:8636240). Detected in endothelial cells around small and large arteries in newborns and adults, but is barely detectable in veins (at protein level) (PubMed:24153254). Detected in lung and testis (PubMed:8636240). {ECO:0000269|PubMed:24153254, ECO:0000269|PubMed:8636240}.
Induction：
Developmental stage：Detected in the extraembryonic region of the visceral endoderm of pre-streak and early-streak embryos. Detected in the extraembryonic region of the visceral endoderm and in the definitive endoderm at 7.5 dpc. By the seven to eight somite stage, detected in the posterior endoderm, mainly in the endoderm of the midgut and hindgut invagination. Expressed in spermatogonia. The expression clearly declines from the early pachytene spermatocyte stage onward. In contrast, expression of isoform 2 (T-SOX17) begins at the pachytene spermatocyte stage and is highly accumulated in round spermatids (PubMed:11973269). Detected in arterial endothelium in embryos and yolk sac at 10.5 dpc (PubMed:24153254). {ECO:0000269|PubMed:11973269, ECO:0000269|PubMed:24153254}.
Protein families：