MYMK_MOUSE Q9D1N4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D1N4
Recommended name：Protein myomaker
EC number：
Alternative names：(Myoblast fusion maker) (Transmembrane protein 8C)
Cleaved into：
GeneID：66139
Gene names (primary )：Mymk
Gene names (synonym )：Tmem8c
Gene names (ORF )：
Length：221
Mass：24792
Sequence：MGTVVAKLLLPTLSSLAFLPTVSIATKRRFYMEAMVYLFTMFFVAFSHACDGPGLSVLCFMRRDILEYFSIYGTALSMWVSLMALADFDEPQRSTFTMLGVLTIAVRTFHDRWGYGVYSGPIGTATLIIAVKWLKKMKEKKGLYPDKSIYTQQIGPGLCFGALALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKVNKKAGNAGAPAKLTFSTLCCTCV
Tissue specificity：Specifically expressed in skeletal muscle during embryogenesis and adult muscle regeneration. {ECO:0000269|PubMed:23868259, ECO:0000269|PubMed:28681861}.
Induction：Expression is induced in muscles in response to muscle injury (PubMed:25085416). Expression is induced in mucle progenitors in response to muscle overload (PubMed:28186492). Down-regulated by microRNA miR-491, which binds specifically to its 3' untranslated region of Mymk leading to its down-regulation (PubMed:28579197). {ECO:0000269|PubMed:25085416, ECO:0000269|PubMed:28186492, ECO:0000269|PubMed:28579197}.
Developmental stage：During embryogenesis, highly expressed in the myotome compartment of the somites, and later in limb buds and axial skeletal muscles. Specifically expressed in skeletal muscle, and not in other muscle tissues or non-muscle tissues. Expression is down-regulated postnatally. {ECO:0000269|PubMed:23868259}.
Protein families：TMEM8 family