PPR3B_MOUSE   Q8C767


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C767

Recommended name:Protein phosphatase 1 regulatory subunit 3B

EC number:

Alternative names:(Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL) (Protein phosphatase 1 regulatory subunit 4) (PP1 subunit R4) (Protein phosphatase 1 subunit GL) (PTG)

Cleaved into:

GeneID:244416

Gene names  (primary ):Ppp1r3b

Gene names  (synonym ):Ppp1r4

Gene names  (ORF ):

Length:284

Mass:32433

Sequence:MAVDIQYSYSSMAPSLRRERFTFKISPKLSKPLRPCIQLGSKDEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQAYWDSNKGKNYRITRAELRSSPGKIEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY

Tissue specificity:Highly expressed in liver (at protein level). Expressed predominantly in liver. Expressed moderately in heart. Expressed weakly in prostate, stomach, thyroid, lung, kidney, spleen and skeletal muscle. {ECO:0000269|PubMed:11872655, ECO:0000269|PubMed:16949035}.

Induction:Up-regulated by TITF1. {ECO:0000269|PubMed:16949035}.

Developmental stage:Expressed in lung at 12.5 and 16.5 dpc and declines thereafter. Expressed in epithelial cells of the bronchus and smooth muscle of the pulmonary artery at 13.5 and 16.5 dpc. {ECO:0000269|PubMed:16949035}.

Protein families:


   💬 WhatsApp