DERL3_MOUSE   Q9D8K3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D8K3

Recommended name:Derlin-3

EC number:

Alternative names:(Degradation in endoplasmic reticulum protein 3) (Der1-like protein 3) (Protein IZP6)

Cleaved into:

GeneID:70377

Gene names  (primary ):Derl3

Gene names  (synonym ):Der3 Izp6

Gene names  (ORF ):

Length:228

Mass:25978

Sequence:MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSLFFLGQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGHIYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLPEEQPEL

Tissue specificity:Highly expressed in spleen, lung, liver, spleen and testis. Expressed at intermediate level in kidney. Weakly or not expressed in brain, heart and skeletal muscle. {ECO:0000269|PubMed:11422294}.

Induction:

Developmental stage:Expressed in neural cells during enbryogenesis. From 11.5 dpc until 14.5 dpc, it is mainly expressed in the forebrain. From 15.5 dpc until birth, expression in the forebrain becomes weaker but is still observed in the olfactory bulb and the skin around the eyes, nose, limbs and tail, showing that its pattern of expression changes from the central nervous system to the peripheral tissues during development. {ECO:0000269|PubMed:11422294}.

Protein families:Derlin family


   💬 WhatsApp