ROP1L_MOUSE Q9EQ00
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EQ00
Recommended name：Ropporin-1-like protein
EC number：
Alternative names：(AKAP-associated sperm protein)
Cleaved into：
GeneID：252967
Gene names (primary )：Ropn1l
Gene names (synonym )：Asp
Gene names (ORF )：
Length：218
Mass：24516
Sequence：MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDRIEMPVATQKTDTGLTQGLLKVLHKQCSHKQYVELADLEKKWKNLCLPVEKLRTILELDPCEDKIEWIKFLALGCSSLGRTLNTAMKNVCEILTSDPEGGPARIPFETFAYVYQYLSGLDPELPAVETENYLTSLRLMSESRKNGMIGLSDFFVGKKII
Tissue specificity：Testis-specific. Expression is restricted to germ cells. {ECO:0000269|PubMed:11278869, ECO:0000269|PubMed:12021058, ECO:0000269|PubMed:23303679}.
Induction：
Developmental stage：Expressed in testis at least from P5 to P40. Expression increases with sample age. Detected in the flagella of elongated spermatids, but the expression levels reduce as the sperm matures (heads move towards the center lumen) (PubMed:23303679). {ECO:0000269|PubMed:12021058, ECO:0000269|PubMed:23303679}.
Protein families：Ropporin family