TDPZ1_MOUSE   P0DMR5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0DMR5

Recommended name:TD and POZ domain-containing protein 1

EC number:

Alternative names:(MAPP family protein 2)

Cleaved into:

GeneID:207213

Gene names  (primary ):Tdpoz1

Gene names  (synonym ):2cpoz56 Mapp2 Spopl1

Gene names  (ORF ):

Length:365

Mass:41584

Sequence:MSEDMEFENWGSTQSSVEKFCYKWTISNFSFCMGGIQRRITSPVFSSEENKEVAWCLRVYPKGADKESKDYLSVYLVLLSHLQIPVWAKFKFWIINSQGEKYQKIKSPTVECFLTNEQNGFKKFLPRDLLLSHRNCLLPEDQLTICCKVTILGRKYNMPSQNITPAIKDPRHLLTDDLGELWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAMFEHEMKESLKTPIKIHNLNPQVFKEMMGFIYTGKAPHLHSHSMACDVLPAADKYGLVSLKVLCEDALCRNLSVKNATHTLILADLHSTEKLKTQALDFIAYYASEVCETSEWKSILESHPHLVAEAFQSLASAQCSFLEPKVISGSNQL

Tissue specificity:

Induction:

Developmental stage:Expressed in unfertilized eggs and pre-implantation embryos. Undetectable in later-stage fetuses or in adult tissues. {ECO:0000269|PubMed:11424210}.

Protein families:Tdpoz family


   💬 WhatsApp