NR2E3_MOUSE Q9QXZ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXZ7
Recommended name：Photoreceptor-specific nuclear receptor
EC number：
Alternative names：(Nuclear receptor subfamily 2 group E member 3) (Retina-specific nuclear receptor)
Cleaved into：
GeneID：23958
Gene names (primary )：Nr2e3
Gene names (synonym )：Pnr Rnr
Gene names (ORF )：
Length：395
Mass：43177
Sequence：MSSTVAASTMPVSVAASKKESPGRWGLGEDPTGVGPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSMAQVHLDAMETGSDPRSEPVVASPALAGPSPRGPTSVSATRAMGHHFMASLITAETCAKLEPEDAEENIDVTSNDPEFPASPCSLDGIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWNELFLLGAIQWSLPLDSCPLLAPPEASGSSQGRLALASAETRFLQETISRFRALAVDPTEFACLKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFLTAERIELLFFRKTIGNTPMEKLLCDMFKN
Tissue specificity：Retina. Rod-specific. Expressed in the outer nuclear lyer of the mature retina. {ECO:0000269|PubMed:10611353, ECO:0000269|PubMed:10805811, ECO:0000269|PubMed:15190009, ECO:0000269|PubMed:15634773, ECO:0000269|PubMed:21408158}.
Induction：
Developmental stage：Expression found as early as 18 dpc in developing retina. From P3 to P6, expression increases in developing rods. Expression, thereafter, in the future inner nuclear layer migrating to the final destination of the outer nuclear layer. In the mature retina, exclusively expressed in rods. {ECO:0000269|PubMed:15634773}.
Protein families：Nuclear hormone receptor family, NR2 subfamily