IFT20_MOUSE Q61025
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61025
Recommended name：Intraflagellar transport protein 20 homolog
EC number：
Alternative names：(mIFT20)
Cleaved into：
GeneID：55978
Gene names (primary )：Ift20
Gene names (synonym )：
Gene names (ORF )：
Length：132
Mass：15237
Sequence：MAKDILGEAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQLERYRVEYEALCKVEAEQNEFIDQFIFQK
Tissue specificity：Expressed predominantly in the testis (at protein level). Expressed in kidney and retina. Expression is up-regulated during spermiogenesis. {ECO:0000269|PubMed:11916979, ECO:0000269|PubMed:12821668, ECO:0000269|PubMed:27682589}.
Induction：
Developmental stage：Expression is first detected at postnatal day 16 (P16) and increases significantly at days P30 and P42. {ECO:0000269|PubMed:27682589}.
Protein families：