YBOX1_MOUSE   P62960


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62960

Recommended name:Y-box-binding protein 1

EC number:

Alternative names:(YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor)

Cleaved into:

GeneID:22608

Gene names  (primary ):Ybx1

Gene names  (synonym ):Msy-1 Msy1 Nsep1 Yb1

Gene names  (ORF ):

Length:322

Mass:35730

Sequence:MSSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

Tissue specificity:Expressed at high levels in the testis (PubMed:8505341). Present in the mRNP particles that mediate the storage and masking of mRNAs during spermiogenesis (PubMed:8505341). In epidermis, expression is restricted to the cycling keratinocyte progenitors (PubMed:29712925). {ECO:0000269|PubMed:29712925, ECO:0000269|PubMed:8505341}.

Induction:

Developmental stage:Found at very low levels at day 10 and levels increase at day 15 and persist throughout adulthood. {ECO:0000269|PubMed:8505341}.

Protein families:YBX1 family


   💬 WhatsApp