PENK_MOUSE   P22005


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P22005

Recommended name:Proenkephalin-A [Cleaved into: Synenkephalin; Met-enkephalin

EC number:

Alternative names:(Opioid growth factor) (OGF); PENK(114-133); PENK(143-184); Met-enkephalin-Arg-Ser-Leu; Leu-enkephalin; PENK(238-259); Met-enkephalin-Arg-Phe]

Cleaved into:

GeneID:18619

Gene names  (primary ):Penk

Gene names  (synonym ):Penk1

Gene names  (ORF ):

Length:268

Mass:31004

Sequence:MARFLRLCTWLLALGSCLLATVQAECSQDCAKCSYRLVRPGDINFLACTLECEGQLPSFKIWETCKDLLQVSRPEFPWDNIDMYKDSSKQDESHLLAKKYGGFMKRYGGFMKKMDELYPMEPEEEANGGEILAKRYGGFMKKDADEGDTLANSSDLLKELLGTGDNRAKDSHQQESTNNDEDMSKRYGGFMRSLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAESLPSDEEGENYSKEVPEIEKRYGGFMRF

Tissue specificity:Spermatogenic and somatic cells.

Induction:

Developmental stage:Highest expression in late pachytene spermatocytes and postmeiotic round spermatids.

Protein families:Opioid neuropeptide precursor family


   💬 WhatsApp