PMM1_MOUSE   O35621


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35621

Recommended name:Phosphomannomutase 1

EC number:EC 5.4.2.8

Alternative names:(PMM 1) (EC 5.4.2.8)

Cleaved into:

GeneID:29858

Gene names  (primary ):Pmm1

Gene names  (synonym ):

Gene names  (ORF ):

Length:262

Mass:29775

Sequence:MAVAVEGARRKERILCLFDVDGTLTPARQKIDPEVSAFLQKLRSRVQIGVVGGSDYSKIAEQLGEGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNETSPGGNDFEIYADPRTVGHSVVSPQDTVQRCRELFFPETAHEA

Tissue specificity:Present in brain, where it is restricted to neuronal cell bodies. Present at lower levels in pancreas, liver, lung, gonads, uterus, adrenal glands and pituitary (at protein level). Undetectable in intestine. {ECO:0000269|PubMed:16847318}.

Induction:

Developmental stage:Highly expressed at 17 dpc in most organs (at protein level). {ECO:0000269|PubMed:16847318}.

Protein families:Eukaryotic PMM family


   💬 WhatsApp