ISK1_MOUSE P09036
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09036
Recommended name：Serine protease inhibitor Kazal-type 1
EC number：
Alternative names：(P12) (Prostatic secretory glycoprotein) (Serine protease inhibitor Kazal-type 3)
Cleaved into：
GeneID：20730
Gene names (primary )：Spink1
Gene names (synonym )：Spink3
Gene names (ORF )：
Length：80
Mass：8488
Sequence：MKVAVIFLLSALALLSLAGNTFSAKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Tissue specificity：In the genital tract, expressed only in male accessory glands including seminal vesicle, coagulating gland and prostate. {ECO:0000269|PubMed:9828198}.
Induction：By androgens in adult male sex accessory glands. Expressed constitutively in pancreas. {ECO:0000269|PubMed:3428272}.
Developmental stage：In the seminal vesicle, not expressed during prepubertal stages; expression coincides with maturation. {ECO:0000269|PubMed:9828198}.
Protein families：