DPA5A_MOUSE Q9CQS7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQS7
Recommended name:Developmental pluripotency-associated protein 5A
EC number:
Alternative names:(mDppa5) (ES cell-associated transcript 2 protein) (Embryonal stem cell-specific gene 1 protein) (ESG-1) (Protein pH 34)
Cleaved into:
GeneID:434423
Gene names (primary ):Dppa5a
Gene names (synonym ):Dppa5 Ecat2 Esg1 Ph34
Gene names (ORF ):
Length:118
Mass:13810
Sequence:MMVTLVTRKDIPPWVKVPEDLKDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKNLESPEELIEVFIYGSQNNKIRAKWMLQSMAERYHLRQQKGVLKLEESMKTLELGQCIE
Tissue specificity:
Induction:Down-regulated by retinoic acid in embryonic carcinoma (EC) cells and in developing germ cells. {ECO:0000269|PubMed:15790765, ECO:0000269|PubMed:2044862}.
Developmental stage:Pluripotent cell-specific. Expressed in zygotes, cleavage-stage embryos and blastocysts, embryonic stem (ES) and embryonic germ (EG) cells. Detected in both the trophectoderm (TE) and inner cell mass (ICM) of blastocysts. More abundant in the ICM than TE at 3.5 dpc blastocyst stage. Expressed in primordial germ (PGC) cells from 10.5 to 13.5 dpc. Expressed in developing gonads from 11.5 to 15.5 dpc. Progressively undetectable in ovary from 13.5 to 15.5 dpc. Undetectable in testis after 15.5 dpc. Not expressed in somatic cells at 13.5 dpc (at protein level). Expressed in embryonic stem (ES) and embryonic carcinoma (EC) cells. Not detected during the differentiation of stem cells or midgestation embryos nor in neonatal tissues. Weakly expressed or not detected in oocytes and fertilized eggs. {ECO:0000269|PubMed:12466296, ECO:0000269|PubMed:12620990, ECO:0000269|PubMed:15790765, ECO:0000269|PubMed:16166252, ECO:0000269|PubMed:16504174, ECO:0000269|PubMed:16872451, ECO:0000269|PubMed:8123591}.
Protein families:KHDC1 family