TDPZ3_MOUSE   Q717B4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q717B4

Recommended name:TD and POZ domain-containing protein 3

EC number:

Alternative names:

Cleaved into:

GeneID:399674

Gene names  (primary ):Tdpoz3

Gene names  (synonym ):

Gene names  (ORF ):

Length:365

Mass:41521

Sequence:MAGDMEFKSWGYTQINVQKFCYNWTISNFSFCMGAHQKSITSPVFSLEASKEVAWCLRLYPNGVDEESKDYLSVYLELLSALESPILAKFEFWIINSQGEKYQSRKISNVQCFLQYEHRGFKKFLLRGLLLSHMNWFLPEDQFTICCKVSIVGTVFDMPVQKRTPAIKDPRHMLTDDLGELWENSLFTDCCLLVAGHEFKAHKAILAARSPVFRAMFENEMKESLKNPIEIMDLDLDVFKEMMGFIYTGKAPHLHSHSMACDVLPAADKYGLVGLKVLCEDVLCRNLSVKTAAHTLILADLNSTEKLKSQALDFIAIHACEVSETSEWKSMWKSHPHLVAEAFHSLASAKCSFLEPNVVLESSQL

Tissue specificity:

Induction:

Developmental stage:Strongly expressed in 2-cell embryos with weak expression detected in other embryonic stages. Also weakly expressed in adult testis. {ECO:0000269|PubMed:14693377}.

Protein families:Tdpoz family


   💬 WhatsApp