RETNG_RAT   G3V686


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:G3V686

Recommended name:Resistin-like gamma Imported

EC number:

Alternative names:

Cleaved into:

GeneID:288135

Gene names  (primary ):Retnlg

Gene names  (synonym ):

Gene names  (ORF ):

Length:111

Mass:11,822

Sequence:MKTAICSLLICIFLLQLMVPVNTDGTLESIVEQKVKELLAHRDNCPSTVTKTLSCTSVKATGRLASCPPGMAVTGCACGYACGSWDIRDGTTCHCQCAVMDWATARCCQLS

Tissue specificity:Highly expressed in bone marrow, spleen and white blood cells. Also detected at low levels in thymus, lung, trachea, white adipose tissue, nasal respiratory epithelium, colon, small intestine, kidney, liver, and heart. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp