PP14B_RAT   Q8K3F3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K3F3

Recommended name:Protein phosphatase 1 regulatory subunit 14B

EC number:

Alternative names:

Cleaved into:

GeneID:259225

Gene names  (primary ):Ppp1r14b

Gene names  (synonym ):Phi1

Gene names  (ORF ):

Length:147

Mass:15,957

Sequence:MADSGPAGGAALAAPAPGPGSGSTGPRVYFQSPPGAAGEGPGGADDDGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDTRAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp