TR106_RAT Q67ET1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q67ET1
Recommended name：Taste receptor type 2 member 106
EC number：
Alternative names：Taste receptor type 2 member 19 (T2R19)
Cleaved into：
GeneID：100310878
Gene names (primary )：Tas2r106 By Similarity
Gene names (synonym )：Tas2r19
Gene names (ORF )：
Length：307
Mass：35,326
Sequence：MLTIPEGILLCFITSGSVLGVLGNGFILHVNCTDCVRQKFSTTGFIFTGLAISRICVICIIISDGYLKLFSPHMVASDAHIIGISYLWIITNHTSTCFATILNLFYFLKIANFSHYIFFCLKRKLNTIFIFLLGCLFISWSVAFPQTVKIFNDKMKHRNTSWKFHLHKSKFIINHILLNLGVIFFCMVAIITSFLLIISLWKHNRKMQLYVSRFKSLNTEVHLKVMKVLISFIILLILHVIGILIETLSFLRYENKLLLILGLNFSSMYPCCHSFILILANNQLKQASLKALKQFKCHKKDKDVRET
Tissue specificity：
Induction：
Developmental stage：
Protein families：