CP4F5_RAT P51870
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51870
Recommended name：Cytochrome P450 4F5
EC number：EC:1.14.14.1
Alternative names：CYPIVF5
Cleaved into：
GeneID：286905
Gene names (primary )：Cyp4f5
Gene names (synonym )：
Gene names (ORF )：
Length：526
Mass：60,681
Sequence：MPWLTVSGLDLGSVVTSTWHLLLLGAASWILARILAWTYSFCENCSRLRCFPQSPKRNWFLGHLGTIQSNEEGMRLVTEMGQTFRDIHLCWLGPVIPVLRLVDPAFVAPLLQAPALVAPKDTTFLRFLKPWLGDGLFLSSGDKWSRHRRLLTPAFHFDILKPYVKIFNQSVNIMHAKWKHLCLEGSARLEMFENISLMTLDSLQKCLFGFDSNCQESPSEYISAILELSSLIIKRSQQLFLYLDFLYYRTADGRRFRKACDLVHNFTDAVIRERRRLLSSQGTDEFLESKTKSKSKTLDFIDVLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVWELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPAIDLLRRCTQDIVLPDGRVIPKGNICVISIFGIHHNPSVWPDPEVFDPFRFDSENRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVVVALTLLRFRVLPDDKEPRRKPEIILRAEGGLWLRMEPLSTDTQ
Tissue specificity：High expression in liver and kidney. Lower expression in brain.
Induction：
Developmental stage：
Protein families：