SH3L3_RAT   B2RZ27


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B2RZ27

Recommended name:SH3 domain-binding glutamic acid-rich-like protein 3 By Similarity

EC number:

Alternative names:

Cleaved into:

GeneID:298544

Gene names  (primary ):Sh3bgrl3

Gene names  (synonym ):rCG_30780 Imported

Gene names  (ORF ):

Length:93

Mass:10,477

Sequence:MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPPQIVNGDHYCGDYELFVEAVEQNTLQEFLKLA

Tissue specificity:Expressed in heart, liver, lung, kidney, spleen, thymus, ovarian follicles, skeletal muscle, brain, lymph node and mammary epithelial and stromal cells (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp