TA2R7_RAT Q9JKE9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKE9
Recommended name：Taste receptor type 2 member 7
EC number：
Alternative names：Taste receptor type 2 member 130 Imported Taste receptor type 2 member 6 (T2R6)
Cleaved into：
GeneID：RGD:1597354
Gene names (primary )：Tas2r7
Gene names (synonym )：Tas2r130 Imported, Tas2r6
Gene names (ORF )：
Length：312
Mass：35,844
Sequence：MTYETDTTLMFVAVCEALVGILGNAFIALVNFMGWMKNRKITAIDLILSSLAMSRICLQCIILLDCIILVQYPDTYNRGKEMRIIDFFWTLTNHLSVWFATCLSIFYFFKIANFFHPLFLWIKWRIDKLILRTLLACLILSLCFSLPVTENLTDDFRRCVKTKERINSTLRCKLNKAGYASVKVNLNLVMLFPFSVSLVSFLLLILSLWRHTRQMQLNVTGYNDPSTTAHVKATKAVISFLVLFIVYCLAFLIATSSYFMPESELAVIWGELIALIYPSSHSFILILGNSKLKQASVRVLCRVKTMLKGRKY
Tissue specificity：Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae. Expressed in the duodenum, antrum and fundus (part of the stomach) and in gastric endocrine cells. 1
Induction：
Developmental stage：
Protein families：