SIVA_RAT P59692
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59692
Recommended name：Apoptosis regulatory protein Siva
EC number：
Alternative names：
Cleaved into：
GeneID：362791
Gene names (primary )：Siva1
Gene names (synonym )：Siva
Gene names (ORF )：
Length：177
Mass：18,899
Sequence：MPKRSCPFTDAAPLQLKVHVSPRELSHGVFAERYSREVFERTKQLLFQGAQAYRDHIWGEGCSINHLPEPLKPGLVGAPQAARGQMLIGPDGRLTRCQAQASEAGLPGAAPIACSSCVRSVDGKAVCSQCERALCGQCVYTCWGCGALACVLCGLADYADDDDGEKTLCTSCAMFEA
Tissue specificity：In post-ischemic kidney, found in cells lining the S3 segment of proximal tubules at 12 hours and 1 day post-ischemia. At five and seven days post-ischemia, found in epithelial cells of papillary proliferations in regenerating tubules. 1
Induction：
Developmental stage：By ischemia. 1
Protein families：