PR8A5_RAT P33579
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P33579
Recommended name：Prolactin-8A5
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Prl8a5
Gene names (synonym )：Prlpc
Gene names (ORF )：
Length：238
Mass：27,246
Sequence：MELALSQPSFFGTLLMLVVSNLLLWEKAASIPACMVEDGGCWDPLREAFNSATQRAETLRNLSDQLYVEFFQNQFSSRQFADLSSQLIRKDETVLKAGTYCHSNRAKPKSRGVNIDIEEYLKMSINFCGFMDQPLFHLVIELSAMEGVPETILSKAKDLEENNRQLLDDLRWILTKVFPTAEIKEEFPSWDYLSFLKSSNKNHKFLAIFNLSSCLDYDTQVHYTLSQILNCLITGKDC
Tissue specificity：Placental basal zone cells.
Induction：
Developmental stage：Mid to late gestation (gestation day 15).
Protein families：