COL_RAT P17084
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P17084
Recommended name：Colipase Curated
EC number：
Alternative names：
Cleaved into：
GeneID：25680
Gene names (primary )：Clps
Gene names (synonym )：
Gene names (ORF )：
Length：112
Mass：12,252
Sequence：MKVLVVLLVTLVAVAYAAPGPRGLFINLEDGEICVNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGVCLDSTRSKQ
Tissue specificity：Expressed by the pancreas. 2 s
Induction：Readily detectable during gestation, reaches adult levels by 17-20 days gestation, rises markedly at 7 days of age but falls to adult levels by 14 days and remains at that level throughout the suckling-weanling period. 1 Publication
Developmental stage：Expression levels increase upon lipid ingestion. 1
Protein families：