ATP8_RAT P11608
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P11608
Recommended name：ATP synthase F(0) complex subunit 8 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：26196
Gene names (primary )：Mt-atp8
Gene names (synonym )：Atp8, Atpase8, Mtatp8
Gene names (ORF )：
Length：67
Mass：7,630
Sequence：MPQLDTSTWFITIISSMATLFILFQLKISSQTFPAPPSPKTMATEKTNNPWESKWTKTYLPLSLPPQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：