S2542_RAT P0C546
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C546
Recommended name：Mitochondrial coenzyme A transporter SLC25A42
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Slc25a42
Gene names (synonym )：
Gene names (ORF )：
Length：318
Mass：35,100
Sequence：MDNGVQEGSVRLGEDAEAVLAGAVSTKANHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTFDLMQILLRQLQS
Tissue specificity：Widely expressed. Highly expressed in adipose, followed by hypothalamus and brain coronal sections containing corpus callosum, fornix, thalamus, hypothalamus, optic chiasm, pons, midbrain, and cerebellum. 1
Induction：
Developmental stage：
Protein families：