OBRG_RAT   Q9JLS8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JLS8

Recommended name:Leptin receptor gene-related protein

EC number:

Alternative names:

Cleaved into:

GeneID:56766

Gene names  (primary ):Leprot

Gene names  (synonym ):Lepr, Obr

Gene names  (ORF ):

Length:131

Mass:14,320

Sequence:MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW

Tissue specificity:Down-regulated by insulin. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp