TRI50_RAT Q810I1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q810I1
Recommended name：E3 ubiquitin-protein ligase TRIM50
EC number：EC:2.3.2.27
Alternative names：RING-type E3 ubiquitin transferase TRIM50 Curated Tripartite motif-containing protein 50
Cleaved into：
GeneID：288596
Gene names (primary )：Trim50
Gene names (synonym )：
Gene names (ORF )：
Length：483
Mass：54,719
Sequence：MAWQLTVPELQDQLQCPICLEVFKEPLMLQCGHSYCKNCLDSLSEHLDSELRCPVCRQSVDCSSSPPNVSLARVIDALRLPGDTEPTVCVHHRNPLSLFCEKDQEFICGLCGLLGSHQHHRVTPVSTVYSRMKEELAGRLSELKEQHRDVEEHIGKLVNNRTRIINESDVFSWVIRREFQELHHLVDEEKARCLEGVESHTRGLVASLDMQLEQAQGTQERLAQAERVLEQFGNESHHEFIRFHSITSRGEVQQARPLEGVFSPISFKPALHQADIKLTVWKRLFRKVLPAPESLKLDPATAHPLLELSKGNTVVHCGLLAQRRASQPERFDYSTCVLASKGFSWGRHYWEVVVGSKSDWRLGVIKGTASRKGKLSKSPEHGVWLIGLKEGRLYEAFGCPRLPLPVAGHPHRIGVYLHYEQGELTFFDADRPDDLRALYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSAPGHLTRAQV
Tissue specificity：
Induction：
Developmental stage：
Protein families：