HSPB8_RAT   Q9EPX0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EPX0

Recommended name:Heat shock protein beta-8

EC number:

Alternative names:Alpha-crystallin C chain Small stress protein-like protein HSP22

Cleaved into:

GeneID:113906

Gene names  (primary ):Hspb8

Gene names  (synonym ):Cryac, Hsp22

Gene names  (ORF ):

Length:196

Mass:21,592

Sequence:MADGQLPFPCSYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSPFGESSFNNELPQDNQEVTCS

Tissue specificity:By heat shock. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp