VISL1_RAT P62762
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62762
Recommended name：Visinin-like protein 1
EC number：
Alternative names：21 kDa CABP Neural visinin-like protein 1 (NVL-1; NVP-1)
Cleaved into：
GeneID：
Gene names (primary )：Vsnl1
Gene names (synonym )：Visl1
Gene names (ORF )：
Length：191
Mass：22,142
Sequence：MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Tissue specificity：Brain and retina. Neuron-specific in the central and peripheral nervous system.
Induction：
Developmental stage：
Protein families：