LYZL4_RAT D4ABW7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D4ABW7
Recommended name：Lysozyme-like protein 4
EC number：
Alternative names：
Cleaved into：
GeneID：363168
Gene names (primary )：Lyzl4
Gene names (synonym )：Lyza 1 Publication
Gene names (ORF )：
Length：145
Mass：16,302
Sequence：MQLYLVLLLISYLLTPIGASILGRCVVAKKLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYENSRDGSTGFGLFQIRDNEWCDHGKNLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPVWSRNCQLSDILDRWLDGCEL
Tissue specificity：Expressed in the brain, lung, ovary, uterus and testis (PubMed:22110709). In testis expressed in the germinal epithelium and on the maturing spermatozoa (at protein level) (PubMed:22110709). 1
Induction：
Developmental stage：Present during stages of postnatal development from 10 to 60 days old (PubMed:22110709). 1
Protein families：