XPP3_RAT B5DEQ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B5DEQ3
Recommended name：Xaa-Pro aminopeptidase 3 Imported
EC number：EC:3.4.11.9
Alternative names：X-Pro aminopeptidase 3
Cleaved into：
GeneID：685823
Gene names (primary )：Xpnpep3
Gene names (synonym )：
Gene names (ORF )：
Length：506
Mass：56,455
Sequence：MLSLLSTPRLVPVIARLRGLSGCMSCLQRRYSLQPVPVKEIPNRYLGQPSPVTHPHLLRPGEVTPGLSQVEYALRRHKLMALVHKEAQGHSGTDHTVVVLSNPIHYMSNDIPYTFHQDNSFLYLCGFQEPDSILVLQSCSGKQLPSHKAMLFVPRRDPGRELWDGPRSGTDGAIALTGVDDAYPLEEFQHLLPKLRAETNMVWYDWMKPSHAQLHSDYMQPLTEAKATSKNKVRSVQHLIQHLRLIKSPAEIKRMQIAGKLTSEAFIETMFASKAPVDEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQKACLTLCSPGTSLENIYSMMLTLMGQKLKDLGIIKTSKESAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITVEPGIYIPEGDTDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEVNDIEQICSRTS
Tissue specificity：Expressed in the kidney, specifically in intercalated cells, but not in principal cells, of the distal convoluted tubule and cortical collecting duct (at protein level). 1
Induction：
Developmental stage：
Protein families：