ZNF22_RAT Q9ERU2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ERU2
Recommended name：Zinc finger protein 22
EC number：
Alternative names：
Cleaved into：
GeneID：360389
Gene names (primary )：Znf22
Gene names (synonym )：Krox25, Zfp422
Gene names (ORF )：
Length：237
Mass：27,286
Sequence：MRLGKPKGGISRSASQGKTYESKRKTARQRQKWGVAIRFDSGLSRRRRNVDEKPYKCTKCSKSFSQSSTLFQHKKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGERFKQSSNLIQHQRIHTGEKPYCCDECGRCFSQSSHLIQHQRTHTGEKPYQCEECDKCFSQSSHLRQHMKVHKEKKSHKRGKNARAKTHPVSWKRGKGRKAVAGLRQVKGAASGLFKKKK
Tissue specificity：Highly expressed in the ameloblast layer of mandibular incisors, moderately expressed in submandibular gland, calvaria, kidney and lung, and expressed at low levels in brain and thymus. 1
Induction：
Developmental stage：Highly expressed in presecretory ameloblasts with very high expression in secretory ameloblasts. Expression decreases in the maturation stage and is very low in the late maturation stage. 1
Protein families：