KHDR2_RAT Q920F3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920F3
Recommended name：KH domain-containing, RNA-binding, signal transduction-associated protein 2
EC number：
Alternative names：
Cleaved into：
GeneID：170843
Gene names (primary )：Khdrbs2
Gene names (synonym )：Slm1
Gene names (ORF )：
Length：349
Mass：38,854
Sequence：MGEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGRKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEESGRGRGIRGRGIRITPTAPSRGRGGAVPPPPPPGRGVLTPRGTTVTRGALPVPPVARGVPTPRARGTAAVPGYRAPPPPAPEAYEEYGYDDGYGGEYDDQTYEAYDNSYVTPTQSVPEYYDYGHGVNEDAYDSYAPEEWTTTRSSLKAPPPRSARGGYREHPYGRY
Tissue specificity：Expressed in the cortex, cerebellum, striatum, midbrain, brainstem and thalamus of the brain (at protein level). Expressed in neurons (at protein level). Expressed in brain and testis. Expressed in the dentate gyrus of the hippocampus. 1
Induction：
Developmental stage：
Protein families：