HIG1A_RAT Q8VH49
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VH49
Recommended name：HIG1 domain family member 1A, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：140937
Gene names (primary )：Higd1a
Gene names (synonym )：Hig1
Gene names (ORF )：
Length：93
Mass：10,301
Sequence：MSTNTDLSLSSYDEGQGSKFIRKARETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHLIHMRVAAQGFVVGAMTLGMGYSMYQEFWAKRKP
Tissue specificity：Expressed in brain and spinal cord. 1
Induction：
Developmental stage：Expression is increased between P1 and P15 in the spinal cord and a differential spatial pattern. In the P1 spinal cord there is a preferential expression in regions of dorsal laminae II and III and laminae IX ventrally; while in P8, the distribution is more widespread and overall expression is increased. 1
Protein families：