KLK6_RAT P36374
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36374
Recommended name：Prostatic glandular kallikrein-6
EC number：EC:3.4.21.35
Alternative names：Glandular kallikrein-8 (rGK-8) P1 kallikrein Tissue kallikrein
Cleaved into：
GeneID：
Gene names (primary )：Klk6
Gene names (synonym )：Klk-8, Klk8
Gene names (ORF )：
Length：261
Mass：29,013
Sequence：MWLLILFLILSLGWNDAAPPGQSRIIGGFNCEKNSQPWQVAVYHFNEPQCGGVLIHPSWVITAAHCYSVNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPGFNLDIIKNHTRKPGNDYSNDLMLLHLKTPADITDGVKVIDLPTEEPKVGSTCLTSGWGSITPLKWEFPDDLQCVNIHLLSNEKCIKAYNDEVTDVMLCAGEMDGGKDICKGDSGGPLICDGVLQGITSWGSMPCGEPNKPSVYTKLIKFTSWMKKVMKENP
Tissue specificity：
Induction：
Developmental stage：
Protein families：